DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Nedd4l

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_036017204.1 Gene:Nedd4l / 83814 MGIID:1933754 Length:1261 Species:Mus musculus


Alignment Length:341 Identity:77/341 - (22%)
Similarity:131/341 - (38%) Gaps:63/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSAD 113
            ||.:.:..|.|..|.|.|:....|.|::....:.|.....:.......:...||:....||.|  
Mouse   571 SPQELSEEVSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDTVAEQAHLPPPSTPTRRARS-- 633

  Fly   114 STYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYN 178
            ||...|.:|:.::....:....|.|..        :.:.:...:....|::|..:....:.|...
Mouse   634 STVTGGEESTPSVAYVHTTPGLPSGWE--------ERKDAKGRTYYVNHNNRTTTWTRPIMQLAE 690

  Fly   179 VRARSDAAAANNPNANPSSQ--QQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPM-S 240
            ..|...|..:||....|..:  :..:.||...::..|....:|...|:.....|....|..|. |
Mouse   691 DGASGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAVKDTLSNPQSPQPSPYNS 755

  Fly   241 MQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQI 305
            .:..||..:|:              ||||||.....:|:.::::|.||:|.|||||:::    .:
Mouse   756 PKPQHKVTQSF--------------LPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKF----PV 802

  Fly   306 LMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHI--------------- 355
            .|..:...|              .|:|||||.|||:.:...|..::|:|.               
Mouse   803 HMRSKASLN--------------PNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTRESVP 853

  Fly   356 ---DRTTSWNDPRMQS 368
               .:.|.|.|||:|:
Mouse   854 LYDSKITQWEDPRLQN 869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 36/126 (29%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/46 (22%)
Nedd4lXP_036017204.1 PHA03378 <107..318 CDD:223065
C2 <367..420 CDD:417471
WW 465..491 CDD:395320
WW 655..684 CDD:395320 4/36 (11%)
WW 768..798 CDD:238122 14/29 (48%)
WW 817..867 CDD:197736 13/49 (27%)
HECTc 928..1257 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.