DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and WWC2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011530571.1 Gene:WWC2 / 80014 HGNCID:24148 Length:1216 Species:Homo sapiens


Alignment Length:112 Identity:37/112 - (33%)
Similarity:57/112 - (50%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 RQLGA----LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTK 321
            |:.|:    ||.|||:|:..||:::|::|.|:.|.|.|||            :|:          
Human     3 RRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPR------------DRL---------- 45

  Fly   322 QTTTSTIANNLG-PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
             |...:.|:.:| .||.|||........:|:|:||::||...|||.|
Human    46 -TKPLSFADCVGDELPWGWEAGFDPQIGVYYIDHINKTTQIEDPRKQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 37/112 (33%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 11/28 (39%)
WWC2XP_011530571.1 WW 12..41 CDD:278809 13/28 (46%)
WW 59..88 CDD:278809 11/28 (39%)
DUF342 <283..385 CDD:302792
YlqD 351..>428 CDD:287979
C2_Kibra 700..823 CDD:176062
vWFA <1058..>1153 CDD:294047
Phage_Nu1 <1117..1192 CDD:294991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.