DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and MAGIX

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_079135.3 Gene:MAGIX / 79917 HGNCID:30006 Length:334 Species:Homo sapiens


Alignment Length:226 Identity:44/226 - (19%)
Similarity:75/226 - (33%) Gaps:75/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IKSNNLVVRVNQDTDDNL---QALFDSVLNPGD-----AKRPLQL-PLRMRKL--PNSFFTPPAP 104
            ::..:||:.:|.::...|   ||: :.:...|.     .:|||:. |.:.|.:  |.....|..|
Human   168 LEVGDLVLHINGESTQGLTHAQAV-ERIRAGGPQLHLVIRRPLETHPGKPRGVGEPRKGVVPSWP 231

  Fly   105 SHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSS 169
            ..|........  .||:||     ..|:||.|..::.:                     .:.|.|
Human   232 DRSPDPGGPEV--TGSRSS-----STSLVQHPPSRTTL---------------------KKTRGS 268

  Fly   170 PASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMS 234
            |..          |..|||:.|..:|           ||..|::.....|.|..           
Human   269 PEP----------SPEAAADGPTVSP-----------PERRAEDPNDQIPGSPG----------- 301

  Fly   235 QDIPMSMQTVHKKQRSYDVISPIQLNRQLGA 265
               |..:.:..:..|:..|....||.:::.|
Human   302 ---PWLVPSEERLSRALGVRGAAQLAQEMAA 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 1/5 (20%)
WW 266..295 CDD:395320 44/226 (19%)
WW 335..364 CDD:395320
MAGIXNP_079135.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
PDZ_signaling 124..206 CDD:238492 7/38 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..306 30/159 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.