DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and herc5.2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005160175.1 Gene:herc5.2 / 794323 ZFINID:ZDB-GENE-090311-16 Length:987 Species:Danio rerio


Alignment Length:275 Identity:57/275 - (20%)
Similarity:96/275 - (34%) Gaps:90/275 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 NPNANPSSQQQPAGPTFPENSAQEFPSGA---PA---------SSAIDLDA---MNTCMSQDIPM 239
            |.:..|.|.......|..:.....:.||:   |.         |||:.|:.   ..:...||..:
Zfish   354 NESTKPKSSMNGGILTLNDRMIDRWVSGSYPWPTVKKEIKKVFSSAVCLNGSFLKPSLDEQDFDL 418

  Fly   240 SMQTVHKKQRSYDVISPIQLNRQLGALP-----PGWEQAKTNDGQIYYLNHTTKSTQWEDPRI-- 297
            ..::..|...:..|||.:....|...||     |..|::.    ::|.|.          |.:  
Zfish   419 VGKSFSKLTDNEKVISEVVKVIQQTLLPSLNPKPAHEESL----RLYLLL----------PELIK 469

  Fly   298 ---QYRQQQ--QILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVT-----ESGDLYFI 352
               ||::.:  :.|.::.::.|...:...:...|       .|||.|.:::.     ||.||  |
Zfish   470 GLEQYQRSELNKALASKILQLNSAAREMLEMFWS-------KLPDDWLKSLVKLFHKESADL--I 525

  Fly   353 NHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLC-----------------SNLFNDAQAI 400
            :::....      |.|.|..|   .||:..||:...:|                 |:|.|..||.
Zfish   526 DYMSVCA------MDSDLKHL---QNLLRILQMAYKVCCSTHRDITISDFIIYEISDLLNALQAT 581

  Fly   401 VNPPSSHKPDDL-EW 414
            :        ||| :|
Zfish   582 I--------DDLADW 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 36/176 (20%)
WW 266..295 CDD:395320 6/33 (18%)
WW 335..364 CDD:395320 9/33 (27%)
herc5.2XP_005160175.1 RCC1_2 120..149 CDD:290274
RCC1 136..186 CDD:278826
RCC1 189..238 CDD:278826
RCC1 242..290 CDD:278826
RCC1 296..347 CDD:278826
HECTc 649..985 CDD:294058
HECTc 678..984 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.