DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Ubr5

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006520242.1 Gene:Ubr5 / 70790 MGIID:1918040 Length:2800 Species:Mus musculus


Alignment Length:480 Identity:90/480 - (18%)
Similarity:163/480 - (33%) Gaps:157/480 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TISAFYMLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDT---DDNLQALFDSVLNPG 79
            ::.||:  :...:.||.:|       |.|..|....:     :.|:|   |:.|:...:|....|
Mouse  1656 SVPAFF--SEDDSQSNDSS-------DSDSSSSQSDD-----IEQETFMLDEPLERTTNSSHANG 1706

  Fly    80 DAKRPLQLPLRMRK---------LPNSFFTPPA---------PSHSRANSADSTYDAGSQSSINI 126
            .|:.|..:...:|.         .|:|..||.|         ||:.|.:...||..|.:.:::..
Mouse  1707 AAQAPRSMQWAVRNPQHQRAASTAPSSTSTPAASSAGLIYIDPSNLRRSGTISTSAAAAAAALEA 1771

  Fly   127 GNKASIVQQPDGQSPIAAIPQLQIQP----SPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAA 187
            .|.:|.:......:...:|...||..    .|:::.|.  :|:.   ||:::..|     .||..
Mouse  1772 SNASSYLTSASSLARAYSIVIRQISDLMGLIPKYNHLV--YSQI---PAAVKLTY-----QDAVN 1826

  Fly   188 ANN-------PNAN------PSSQQQ------------PAGPTFP----ENSAQEFPSGAPASSA 223
            ..|       |..|      .|::.|            |..|..|    :|||:.....|...::
Mouse  1827 LQNYVEEKLIPTWNWMVSVMDSTEAQLRYGSALASAGDPGHPNHPLHASQNSARRERMTAREEAS 1891

  Fly   224 ID----------LDAMNTCMSQ-----DIPMSMQTVHKKQRS-----YDVISPIQLNRQLGALPP 268
            :.          |.|....||.     :..:|:...|..:.|     .||.|...:.....||  
Mouse  1892 LRTLEGRRRATLLSARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQAL-- 1954

  Fly   269 GWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQIL-----MAERIKQNDVLQTTKQTTTSTI 328
                       ||::....:.|..:.|:::.::.:::|     ..:...:||  ..|.|:.|   
Mouse  1955 -----------IYWIKAMNQQTTLDTPQLERKRTRELLELGIDNEDSEHEND--DDTSQSAT--- 2003

  Fly   329 ANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDP--RMQSGLSVLDC-PDN-----LVSSLQI 385
                          :.:..|    :.:...|..|.|  |....::.|.| |.|     |..::.:
Mouse  2004 --------------LNDKDD----DSLPAETGQNHPFFRRSDSMTFLGCIPPNPFEVPLAEAIPL 2050

  Fly   386 EDNLCSNLFNDAQAIVNPPSSHKPD 410
            .|          |..:..|::.|.|
Mouse  2051 AD----------QPHLLQPNARKED 2065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 24/155 (15%)
WW 266..295 CDD:395320 4/28 (14%)
WW 335..364 CDD:395320 3/28 (11%)
Ubr5XP_006520242.1 CUE_UBR5 184..230 CDD:270606
ZnF_UBR1 1177..1244 CDD:197698
PolyA 2391..2454 CDD:197769
HECTc 2469..2797 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.