DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yki and Herc4

DIOPT Version :9

Sequence 1:	NP_001350857.1	Gene:	yki / 37851	FlyBaseID:	FBgn0034970	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_084390.1	Gene:	Herc4 / 67345	MGIID:	1914595	Length:	1057	Species:	Mus musculus

Alignment Length:	137	Identity:	30/137 - (21%)
Similarity:	51/137 - (37%)	Gaps:	25/137 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 IDDEDMLSPIKSNNLVVRVNQDTDDNLQ-ALFDSVLNPG-----------------DAKRPLQLP 88
            ||:|.:|.|.:|:..|.:..:|....|: .:|  ||:.|                 ..|:|.|:.
Mouse    17 IDEEIVLEPRRSDFFVNKKVRDVGCGLRHTVF--VLDDGTVYTCGCNDLGQLGHEKSRKKPEQVV 79

  Fly    89 LRMRKLPNSFFTPPAPSHSRA-NSADSTYDAGSQSSINIGNKAS--IVQQPDGQSPIAAIPQLQI 150
              .....|........:|:.| |.....|..|..|...:|.:.|  .::.|.....::.|..:|:
Mouse    80 --ALDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQV 142

  Fly   151 QPSPQHS 157
            .....||
Mouse   143 ACGYYHS 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yki	NP_001350857.1	HUL4	<261..>404	CDD:227354
		WW	266..295	CDD:395320
		WW	335..364	CDD:395320
Herc4	NP_084390.1	RCC1 1	1..51		11/35 (31%)
		RCC1	3..49	CDD:278826	10/33 (30%)
		RCC1 2	52..101		7/50 (14%)
		RCC1	52..99	CDD:278826	6/48 (13%)
		RCC1 3	102..154		10/48 (21%)
		RCC1	102..152	CDD:278826	10/48 (21%)
		RCC1 4	156..207
		RCC1	157..205	CDD:278826
		RCC1 5	208..259
		RCC1	208..257	CDD:278826
		RCC1	260..308	CDD:278826
		RCC1 6	261..311
		RCC1 7	313..366
		RCC1	313..>343	CDD:278826
		HECTc	709..1055	CDD:238033
		HECTc	735..1054	CDD:214523
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900