DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yki and plekha7a

DIOPT Version :9

Sequence 1:	NP_001350857.1	Gene:	yki / 37851	FlyBaseID:	FBgn0034970	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001129715.1	Gene:	plekha7a / 571486	ZFINID:	ZDB-GENE-050419-75	Length:	1197	Species:	Danio rerio

Alignment Length:	130	Identity:	30/130 - (23%)
Similarity:	52/130 - (40%)	Gaps:	38/130 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||.........||::::::...::|.|..|    |..|.:.....|:.:
Zfish    10 LPDNGSYGVCRDGRVFFIDDEARATTWLHP----RTGQPVNSGHMIRSD---------------- 54

  Fly   331 NLGPLPDGWEQAVTESGDLYFINHIDRTTSW------------NDPRMQS--GLSVLDCPDNLVS 381
                ||.|||:..|:.|..:||:|..|||::            :|.|:|.  |..:|..|.:.:|
Zfish    55 ----LPSGWEEGFTKEGASFFIDHNQRTTTFIHPVTGQISTENSDFRLQDQPGGRMLKQPSSTIS 115

Fly 382 381
Zfish 116 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yki	NP_001350857.1	HUL4	<261..>404	CDD:227354	30/130 (23%)
		WW	266..295	CDD:395320	6/28 (21%)
		WW	335..364	CDD:395320	13/40 (33%)
plekha7a	NP_001129715.1	WW	55..84	CDD:278809	13/28 (46%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	98..148		5/18 (28%)
		PH_PEPP1_2_3	153..256	CDD:270068
		PH	159..255	CDD:278594
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	348..384
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	423..467
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	508..577
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	830..928
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1032..1064
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900