DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and plekha5

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021330752.1 Gene:plekha5 / 567300 ZFINID:ZDB-GENE-041210-25 Length:1398 Species:Danio rerio


Alignment Length:149 Identity:37/149 - (24%)
Similarity:61/149 - (40%) Gaps:35/149 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 LGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTST 327
            |..||..|....|.||:::::|...|||.|..|               :....|:...::|.   
Zfish    10 LSCLPSSWSYGVTRDGRVFFINEEAKSTTWLHP---------------VTGEAVITGHRKTP--- 56

  Fly   328 IANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNL-CS 391
                  .||.|||:..|..|...||||.:|..:...|     :|.:...||.:  ..:.::| |.
Zfish    57 ------DLPTGWEEGYTFEGARCFINHNERKVTCKHP-----VSGVPSQDNCI--FVVNEHLNCG 108

  Fly   392 NLFNDAQAIVNPPSSHKPD 410
            ||   ...:::.|::..|:
Zfish   109 NL---VHPVLSRPATKAPE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 35/141 (25%)
WW 266..295 CDD:395320 11/28 (39%)
WW 335..364 CDD:395320 12/28 (43%)
plekha5XP_021330752.1 WW 13..42 CDD:306827 11/28 (39%)
WW 58..87 CDD:306827 12/28 (43%)
PH_PEPP1_2_3 177..280 CDD:270068
SMC_N 822..>983 CDD:330553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.