DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and wwc3

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001103940.1 Gene:wwc3 / 566492 ZFINID:ZDB-GENE-070209-229 Length:1148 Species:Danio rerio


Alignment Length:103 Identity:37/103 - (35%)
Similarity:55/103 - (53%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||||||:|:..||:::|::|.|:.|.|.|||            :||           |...|.|:
Zfish    17 LPPGWEEARDYDGRVFYIDHNTRQTSWIDPR------------DRI-----------TKPLTFAD 58

  Fly   331 NLG-PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
            .:| .||.|||....:...:|:|:||::||...:||.|
Zfish    59 CVGDELPLGWEVVYDQQVGVYYIDHINKTTQIENPRTQ 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 37/103 (36%)
WW 266..295 CDD:395320 14/28 (50%)
WW 335..364 CDD:395320 11/28 (39%)
wwc3NP_001103940.1 WW 17..46 CDD:278809 14/28 (50%)
WW 64..93 CDD:278809 11/28 (39%)
C2_Kibra 677..800 CDD:176062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.