Sequence 1: | NP_001350857.1 | Gene: | yki / 37851 | FlyBaseID: | FBgn0034970 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001314782.1 | Gene: | magi2a / 564112 | ZFINID: | ZDB-GENE-050810-4 | Length: | 1503 | Species: | Danio rerio |
Alignment Length: | 222 | Identity: | 64/222 - (28%) |
---|---|---|---|
Similarity: | 93/222 - (41%) | Gaps: | 60/222 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 PNANPSSQ-----------QQPAGPTFPENSAQEFP----SG---APASSAID---LDAMNTCMS 234
Fly 235 QDIPMSMQTVHKKQRSYDVISPIQ--LNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRI 297
Fly 298 QYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWN 362
Fly 363 DP------------RMQS-GLSVLDCP 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yki | NP_001350857.1 | HUL4 | <261..>404 | CDD:227354 | 40/129 (31%) |
WW | 266..295 | CDD:395320 | 13/28 (46%) | ||
WW | 335..364 | CDD:395320 | 10/28 (36%) | ||
magi2a | NP_001314782.1 | PDZ_signaling | 25..100 | CDD:238492 | |
NK | 122..286 | CDD:302627 | 20/77 (26%) | ||
WW | 307..337 | CDD:238122 | 14/29 (48%) | ||
WW | 352..381 | CDD:278809 | 10/28 (36%) | ||
PDZ | 431..511 | CDD:214570 | |||
PDZ | 595..676 | CDD:214570 | |||
PDZ | 762..856 | CDD:214570 | |||
PDZ_signaling | 920..1007 | CDD:238492 | |||
PDZ_signaling | 1182..1262 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |