DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and magi2a

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001314782.1 Gene:magi2a / 564112 ZFINID:ZDB-GENE-050810-4 Length:1503 Species:Danio rerio


Alignment Length:222 Identity:64/222 - (28%)
Similarity:93/222 - (41%) Gaps:60/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PNANPSSQ-----------QQPAGPTFPENSAQEFP----SG---APASSAID---LDAMNTCMS 234
            |.|.|:||           .:.||...||...:|.|    :|   .|.||..:   .||... |:
Zfish   209 PGATPTSQGKRRRNKSVSNMEKAGIEPPEEEEEERPVINGNGVAITPESSEHEDKSTDASGE-MA 272

  Fly   235 QDIPMSMQTVHKKQRSYDVISPIQ--LNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRI 297
            ...|....|...|:.:....||.:  .|.:||.||..||.|.|..|::|:::|.||:|.|.|||:
Zfish   273 TTCPSETSTDAPKEDTEPPKSPPKPDENDELGPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRL 337

  Fly   298 QYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWN 362
            ..:.:.    .|..|:|:                   ||.|||:........|:::||:|.|.:.
Zfish   338 AKKAKP----PEECKENE-------------------LPYGWEKIDDPIYGTYYVDHINRRTQFE 379

  Fly   363 DP------------RMQS-GLSVLDCP 376
            :|            :||| |||.|..|
Zfish   380 NPVLEAKRRLQHQQQMQSQGLSSLPLP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 40/129 (31%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
magi2aNP_001314782.1 PDZ_signaling 25..100 CDD:238492
NK 122..286 CDD:302627 20/77 (26%)
WW 307..337 CDD:238122 14/29 (48%)
WW 352..381 CDD:278809 10/28 (36%)
PDZ 431..511 CDD:214570
PDZ 595..676 CDD:214570
PDZ 762..856 CDD:214570
PDZ_signaling 920..1007 CDD:238492
PDZ_signaling 1182..1262 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.