DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and smurf2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001107898.1 Gene:smurf2 / 563633 ZFINID:ZDB-GENE-030131-1830 Length:765 Species:Danio rerio


Alignment Length:278 Identity:74/278 - (26%)
Similarity:109/278 - (39%) Gaps:102/278 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 IDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGA--------------LPPGWEQAK 274
            :||:.:.       |....||    |...|:| :|...::|:              ||.|||:.:
Zfish   115 LDLNKLG-------PNDSDTV----RGQIVVS-LQSRDRIGSGGPVVDCSRLFDNDLPDGWEERR 167

  Fly   275 TNDGQIYYLNHTTKSTQWE--------------------------------------DPRIQYR- 300
            |..|:|.||||.|:|||||                                      |||:|.| 
Zfish   168 TASGRIQYLNHITRSTQWERPTRPASEYSSPGRPLSCLVDENTPIMTPNGAAGVPADDPRVQERR 232

  Fly   301 ---QQQQILMA----------------ERIKQNDVLQTTKQTTTST---------IAN----NLG 333
               |:.:..|:                ...:|..|.....||..||         ::|    .||
Zfish   233 VRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEELG 297

  Fly   334 PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCS---NLFN 395
            |||.|||...|.:|.:||::|.:|||.:.|||:.:.|.::..|....|...:|....|   .|..
Zfish   298 PLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSPNGSRAAVEAQSSSRPGQLKE 362

  Fly   396 DAQAIVNPPSSHKPDDLE 413
            .||::|:|  .:.|:|.|
Zfish   363 QAQSVVSP--GNLPEDPE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 61/230 (27%)
WW 266..295 CDD:395320 18/66 (27%)
WW 335..364 CDD:395320 13/28 (46%)
smurf2NP_001107898.1 C2_Smurf-like 13..137 CDD:176028 8/33 (24%)
WW 159..188 CDD:278809 18/28 (64%)
WW 252..283 CDD:197736 6/30 (20%)
WW 298..330 CDD:197736 16/31 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..375 8/35 (23%)
HECTc 410..762 CDD:238033
HECTc 437..762 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.