Sequence 1: | NP_001350857.1 | Gene: | yki / 37851 | FlyBaseID: | FBgn0034970 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107898.1 | Gene: | smurf2 / 563633 | ZFINID: | ZDB-GENE-030131-1830 | Length: | 765 | Species: | Danio rerio |
Alignment Length: | 278 | Identity: | 74/278 - (26%) |
---|---|---|---|
Similarity: | 109/278 - (39%) | Gaps: | 102/278 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 IDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGA--------------LPPGWEQAK 274
Fly 275 TNDGQIYYLNHTTKSTQWE--------------------------------------DPRIQYR- 300
Fly 301 ---QQQQILMA----------------ERIKQNDVLQTTKQTTTST---------IAN----NLG 333
Fly 334 PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCS---NLFN 395
Fly 396 DAQAIVNPPSSHKPDDLE 413 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yki | NP_001350857.1 | HUL4 | <261..>404 | CDD:227354 | 61/230 (27%) |
WW | 266..295 | CDD:395320 | 18/66 (27%) | ||
WW | 335..364 | CDD:395320 | 13/28 (46%) | ||
smurf2 | NP_001107898.1 | C2_Smurf-like | 13..137 | CDD:176028 | 8/33 (24%) |
WW | 159..188 | CDD:278809 | 18/28 (64%) | ||
WW | 252..283 | CDD:197736 | 6/30 (20%) | ||
WW | 298..330 | CDD:197736 | 16/31 (52%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 341..375 | 8/35 (23%) | |||
HECTc | 410..762 | CDD:238033 | |||
HECTc | 437..762 | CDD:214523 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |