powered by:
Protein Alignment yki and HERC6
DIOPT Version :9
Sequence 1: | NP_001350857.1 |
Gene: | yki / 37851 |
FlyBaseID: | FBgn0034970 |
Length: | 418 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005263140.1 |
Gene: | HERC6 / 55008 |
HGNCID: | 26072 |
Length: | 1034 |
Species: | Homo sapiens |
Alignment Length: | 55 |
Identity: | 14/55 - (25%) |
Similarity: | 21/55 - (38%) |
Gaps: | 3/55 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 HSRANSADS---TYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHS 157
||.|.|.|| ::...|...:.:|.:......|.....:..||..|:.....||
Human 151 HSLALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHS 205
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5021 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.