DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HERC6

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:55 Identity:14/55 - (25%)
Similarity:21/55 - (38%) Gaps:3/55 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HSRANSADS---TYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHS 157
            ||.|.|.||   ::...|...:.:|.:......|.....:..||..|:.....||
Human   151 HSLALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274
RCC1_2 89..118 CDD:290274
RCC1 105..155 CDD:278826 2/3 (67%)
RCC1 158..208 CDD:278826 10/48 (21%)
RCC1 215..263 CDD:278826
RCC1_2 250..279 CDD:290274
RCC1 266..313 CDD:278826
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.