DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and PLEKHA5

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001243399.1 Gene:PLEKHA5 / 54477 HGNCID:30036 Length:1282 Species:Homo sapiens


Alignment Length:152 Identity:38/152 - (25%)
Similarity:58/152 - (38%) Gaps:40/152 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQT 323
            ||.:..:||..|....|..|:::::|...|||.|..|          :..|.:......|:|   
Human     5 LNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHP----------VTGEAVVTGHRRQST--- 56

  Fly   324 TTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDN 388
                      .||.|||:|.|..|..|:|||.:|..:...|               |:....:||
Human    57 ----------DLPTGWEEAYTFEGARYYINHNERKVTCKHP---------------VTGQPSQDN 96

  Fly   389 LCSNLFNDAQAIVNPPSSHKPD 410
             |..:.|: |.:....|..|.:
Human    97 -CIFVVNE-QTVATMTSEEKKE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 34/142 (24%)
WW 266..295 CDD:395320 10/28 (36%)
WW 335..364 CDD:395320 13/28 (46%)
PLEKHA5NP_001243399.1 WW 12..41 CDD:278809 10/28 (36%)
WW 58..87 CDD:278809 13/28 (46%)
PH_PEPP1_2_3 164..267 CDD:270068
PH 170..266 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.