DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HERC5

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011530324.2 Gene:HERC5 / 51191 HGNCID:24368 Length:1100 Species:Homo sapiens


Alignment Length:374 Identity:72/374 - (19%)
Similarity:123/374 - (32%) Gaps:135/374 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RPLQLPLR-MRKLPNSFFTPPAPS--------------------HSRANS----ADSTYDAGSQS 122
            |||:.... |.:.|.....||..|                    |:.|.|    ..:|.:|  ..
Human    67 RPLKTTTNIMFRFPLELQAPPPNSTWGAWRPGRGSVAEAAVPRRHAAARSWFPLCSATPEA--VG 129

  Fly   123 SINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAA 187
            :::.|.:.|::      ||:...|           |.|....|:|.     :...|.|:.:..||
Human   130 ALSPGTRRSLL------SPLGLGP-----------RKAAMERRSRR-----KSRRNGRSTAGKAA 172

  Fly   188 ANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSA----IDLDAMNTCMSQDIPM------SMQ 242
            |..|..:|.:|            ...|||.|....|    :::.....|....:.:      .:|
Human   173 ATQPAKSPGAQ------------LWLFPSAAGLHRALLRRVEVTRQLCCSPGRLAVLERGGAGVQ 225

  Fly   243 TVHKKQRSYDVISP--IQL--NRQLGALPPGWEQ--AKTNDGQIY-YLNHTTKSTQWEDPRIQYR 300
            .......|....:|  |:|  |.::.::..|.|.  ..::||:.: |.|::.|..::|       
Human   226 VHQLLAGSGGARTPKCIKLGKNMKIHSVDQGAEHMLILSSDGKPFEYDNYSMKHLRFE------- 283

  Fly   301 QQQQILMAERI---------------------------KQNDVLQTTKQTTTSTIANNLGPLP-- 336
               .||..::|                           .|..|.:....|||..|..:|..:|  
Human   284 ---SILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTTPQIVEHLAGVPLA 345

  Fly   337 -----DGWEQAVTESGDLYF----------INHIDRTTSWNDPRMQSGL 370
                 :....|::.||::|.          :.|   |.|.:||.:..||
Human   346 QISAGEAHSMALSMSGNIYSWGKNECGQLGLGH---TESKDDPSLIEGL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 30/157 (19%)
WW 266..295 CDD:395320 8/31 (26%)
WW 335..364 CDD:395320 8/45 (18%)
HERC5XP_011530324.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.