DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Magi1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_038964101.1 Gene:Magi1 / 500261 RGDID:1586025 Length:1491 Species:Rattus norvegicus


Alignment Length:229 Identity:53/229 - (23%)
Similarity:92/229 - (40%) Gaps:59/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 AIH--HSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASS 222
            |:|  .|.::.|.....::||                   ..|.||....||..:|         
  Rat   206 ALHSLQSGSKQSTPKRTKSYN-------------------DMQNAGIVHTENEEEE--------- 242

  Fly   223 AIDLDAMNTCMS-----QDIPMSMQT-------------VHKKQRSYDVISPIQLNRQLGALPPG 269
              |:..||:..:     ||.|...:.             :....:.:....|:.....||.||..
  Rat   243 --DVPEMNSSFTADSGDQDEPTLQEATLPPVNSSALAAPITDPSQKFPQYLPLSAEDNLGPLPEN 305

  Fly   270 WEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGP 334
            ||.|.|.:|::|:::|.||:|.|.|||...:||:.:...|..::.        ..|..:.:.| .
  Rat   306 WEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEEG--------VHTEELDSEL-E 361

  Fly   335 LPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQS 368
            ||.|||:.......:|:::||:|.|.:.:|.:::
  Rat   362 LPAGWEKIEDPVYGVYYVDHINRKTQYENPVLEA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 34/108 (31%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
Magi1XP_038964101.1 NK 122..293 CDD:418433 18/116 (16%)
WW 302..331 CDD:395320 13/28 (46%)
WW 362..393 CDD:197736 11/30 (37%)
PDZ 469..555 CDD:214570
PDZ 640..723 CDD:214570
MAGI_u5 724..806 CDD:406953
PDZ_signaling 847..922 CDD:238492
PDZ_signaling 996..1091 CDD:238492
PDZ 1152..1234 CDD:214570
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.