DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Wwc2

DIOPT Version :10

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102581.1 Gene:Wwc2 / 498630 RGDID:1559427 Length:1194 Species:Rattus norvegicus


Alignment Length:112 Identity:37/112 - (33%)
Similarity:56/112 - (50%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 RQLGA----LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTK 321
            |:.|:    ||.|||:|:..||:::|::|.|:.|.|.|||            :|:          
  Rat     3 RRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPR------------DRL---------- 45

  Fly   322 QTTTSTIANNLG-PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
             |...:.|:.:| .||.|||.........|:|:||::||...|||.|
  Rat    46 -TKPLSFADCVGDELPWGWEAGFDPQIGAYYIDHINKTTQIEDPRKQ 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 37/112 (33%)
WW 266..295 CDD:459800 13/28 (46%)
WW 335..364 CDD:459800 11/28 (39%)
Wwc2NP_001102581.1 WW 12..41 CDD:459800 13/28 (46%)
WW 59..88 CDD:459800 11/28 (39%)
SMC_prok_B <162..>418 CDD:274008
C2_Kibra 699..822 CDD:176062
ATP-synt_Fo_b <1081..1168 CDD:473877
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.