DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Nedd4

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_648993.1 Gene:Nedd4 / 39958 FlyBaseID:FBgn0259174 Length:1007 Species:Drosophila melanogaster


Alignment Length:362 Identity:77/362 - (21%)
Similarity:135/362 - (37%) Gaps:105/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRV--------NQD-TDDNLQALFDSVLNPGDAK 82
            |.||..||               |..:|.::.::        :|| |.|:...:::|:.:|...:
  Fly   339 TSSAPPNT---------------PTNNNGILAQIAMQYRAEEDQDPTVDHTSFVYNSLRHPVAHR 388

  Fly    83 RP------LQLPLR-MRK---LPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPD 137
            :|      ||..|| :|:   :|:...|.|....:..|.|..   ||.|...........:||  
  Fly   389 QPEISATSLQNDLRPVREAPGVPDIAITNPFTRRAAGNMAGG---AGWQQERRRQQMQLHIQQ-- 448

  Fly   138 GQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRAR-SDAAAANNPNANPSSQQQP 201
                     ..|.|...|.:|:.:.....:..|....|.:..:.| |:....:..:.|||....|
  Fly   449 ---------HQQRQQQQQQNRILLDVDHRQQEPQHRGQRHQQQHRPSNEDTDHTDSHNPSDISAP 504

  Fly   202 AGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGAL 266
            :    ...:::|..:..|                  ||...|..:::                .|
  Fly   505 S----TRRNSEEDNAAVP------------------PMEQNTGGEEE----------------PL 531

  Fly   267 PPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANN 331
            ||.|......:|:.::::|.::.|.|.|||                  :...:.....|..:.::
  Fly   532 PPRWSMQVAPNGRTFFIDHASRRTTWIDPR------------------NGRASPMPNQTRRVEDD 578

  Fly   332 LGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQS 368
            |||||:|||:.|...|.:::|:|..|||.|.|||:.:
  Fly   579 LGPLPEGWEERVHTDGRVFYIDHNTRTTQWEDPRLSN 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 31/108 (29%)
WW 266..295 CDD:395320 8/28 (29%)
WW 335..364 CDD:395320 13/28 (46%)
Nedd4NP_648993.1 C2_NEDD4_NEDD4L 71..204 CDD:175999
WW 248..277 CDD:278809
WW 531..560 CDD:278809 8/28 (29%)
WW 581..613 CDD:197736 16/31 (52%)
HECTc 650..1003 CDD:238033
HECTc 674..1003 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.