DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and CG5087

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_648279.1 Gene:CG5087 / 39035 FlyBaseID:FBgn0035953 Length:1078 Species:Drosophila melanogaster


Alignment Length:145 Identity:25/145 - (17%)
Similarity:49/145 - (33%) Gaps:45/145 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 FPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQ---TVHKKQRSYDVISPIQLNRQLGALP 267
            |..|...:|     .|..:.:.|:...:.|.:|..::   ::...:::..:...:|...:.|...
  Fly   250 FSRNLLAKF-----LSEILSVPALIYHLQQSVPQCLEQFSSMGLLKKALSISGDVQWFEEFGTSM 309

  Fly   268 PGWEQAK---------TNDGQ-----IYY--LNHTTKS---------------TQWED------P 295
            ||.:...         ..|||     :.|  |..||.|               |||.:      |
  Fly   310 PGTKSLAFLGNIVNLFNIDGQGESKELAYPLLTETTTSLLELIPNTVTTKGVFTQWHELLGWHTP 374

  Fly   296 RIQYRQQQQILMAER 310
            ..:..|.|.:.:.::
  Fly   375 GPEPAQNQNVALIKK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 17/87 (20%)
WW 266..295 CDD:395320 13/65 (20%)
WW 335..364 CDD:395320
CG5087NP_648279.1 HECTc 694..1076 CDD:238033
HECTc 718..1075 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.