DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Smurf

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001261061.1 Gene:Smurf / 36999 FlyBaseID:FBgn0029006 Length:1061 Species:Drosophila melanogaster


Alignment Length:368 Identity:83/368 - (22%)
Similarity:123/368 - (33%) Gaps:140/368 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQ--SPIAAI--PQLQIQPSPQ 155
            |.|..|.|....|.:||:    .||.:         ::.|:|..:  :|.::.  ..:::..:..
  Fly   279 PVSATTTPGKKTSSSNSS----SAGGR---------TLEQRPTNEPATPTSSTTSASVRLHSNDN 330

  Fly   156 HSRLAIHHSRARSSPASL------QQNY-NVRARSDAAAANNPN--ANPSSQQ------------ 199
            |.:...|.:...:.|.|.      |||| |..|::.:.:.|...  |.|.|..            
  Fly   331 HVKTPKHQTNGHAPPESTPTSPTGQQNYVNGNAQNGSTSGNGSGQAAQPQSASNGWTQEDAATTT 395

  Fly   200 QPAGPTFPENSAQEFPS---GAPASSAIDLDAMNTCMSQDIPMSMQTVHKK------------QR 249
            .|:..|.|...:|..|:   ..|||..              |.:...||..            .|
  Fly   396 SPSTTTSPPRHSQSPPTPNISPPASVT--------------PSANGNVHSPNANSTPAGSGGGSR 446

  Fly   250 SYDVISPIQ-----LNRQLGA-------------------------------------------- 265
            ||...:|.|     .:||.|.                                            
  Fly   447 SYTAATPGQRSQRRSSRQQGEESSTRRRSSRGTRNGGTSGGGGGGGSGQRYASAAIAAANQAARP 511

  Fly   266 ---LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTST 327
               ||||:|...|..||:|:.:..|..:.|.||||......|.|..:.|                
  Fly   512 FLDLPPGYEMRTTQQGQVYFYHIPTGVSTWHDPRIPRDFDTQHLTLDAI---------------- 560

  Fly   328 IANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGL 370
                 ||||.||||..|.||.:||::|.:|||.:.|||:...:
  Fly   561 -----GPLPSGWEQRKTASGRVYFVDHNNRTTQFTDPRLSGSI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 41/157 (26%)
WW 266..295 CDD:395320 11/28 (39%)
WW 335..364 CDD:395320 15/28 (54%)
SmurfNP_001261061.1 C2_Smurf-like 14..135 CDD:176028
WW 169..198 CDD:278809
WW 514..546 CDD:197736 13/31 (42%)
WW 562..594 CDD:197736 18/31 (58%)
HECTc 702..1058 CDD:238033
HECTc 726..1058 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.