DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Herc3

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001102101.1 Gene:Herc3 / 362377 RGDID:1307803 Length:1050 Species:Rattus norvegicus


Alignment Length:405 Identity:67/405 - (16%)
Similarity:122/405 - (30%) Gaps:139/405 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HSRANSADS---TYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHS---------- 157
            |..|.:||.   |:...|...:.:|.:......|.....:..||..|:.....||          
  Rat   148 HCLALAADGQFFTWGKNSHGQLGLGKEFPSQTSPQRVRSLEGIPLAQVAAGGAHSFALSLSGAVF 212

  Fly   158 --------RLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEF 214
                    :|.:...:.|.||..::.   :|.:.....:       ..::..|..|   .|...|
  Rat   213 GWGMNNAGQLGLSDEKDRESPCHVKL---LRTQKVVYIS-------CGEEHTAVLT---KSGGVF 264

  Fly   215 PSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLG--------------A 265
            ..||.:...:..|::|                     |.::|.::...:|              |
  Rat   265 TFGAGSCGQLGHDSVN---------------------DEVNPRRVLELMGSEVTQIACGRQHTLA 308

  Fly   266 LPPGWEQAKTNDGQIYYL----------NHTTK-------STQW---------EDPRIQYRQQQQ 304
            |.|       :.|.||..          .||..       ...|         ...|.:||..:|
  Rat   309 LVP-------SSGLIYAFGCGAKGQLGTGHTCNVKCPSPVKGHWAAHSGQLSARADRFKYRVVKQ 366

  Fly   305 ILMAERIKQNDVLQTTKQTTTSTI-------ANNLGPLPDG----WEQAVTESGDLYFINHIDRT 358
            |....  .|..||.:|.:.::..:       |:....:.|.    |.|.:||..:...:|.:.:.
  Rat   367 IFSGG--DQTFVLCSTYENSSPAVDFRTVNQAHYTNLINDETIAVWRQKLTEHNNANTVNGVVQI 429

  Fly   359 TS----WN--------DPRMQSGLSVLDCPDNLVSSLQI---------EDNLCSNLFNDAQAIVN 402
            .|    ||        |...::...:   |...::|.::         ...:...:.|..::.:.
  Rat   430 LSSAACWNGSFLEKKIDEHFKTSPKI---PGIDLNSTRVLFEKLMHSQHSMILEQILNSFESCLI 491

  Fly   403 PPSSHKPDDLEWYKI 417
            |..|..|.|:|..:|
  Rat   492 PQLSSSPPDVEAMRI 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 33/214 (15%)
WW 266..295 CDD:395320 8/54 (15%)
WW 335..364 CDD:395320 9/44 (20%)
Herc3NP_001102101.1 ATS1 2..331 CDD:227511 35/223 (16%)
RCC1 313..377 CDD:395335 12/65 (18%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.