DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Herc6

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:239 Identity:53/239 - (22%)
Similarity:83/239 - (34%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 NPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRA---NSADSTYDAGSQSSINIGNKASIVQQPDG 138
            :|...|||  .|::.....:.........||.|   .....|:.|||:..:.||....|...|..
  Rat    57 SPQSTKRP--EPIQALSTVHIDLVSCGKEHSVAVCHQGRVFTWGAGSEGQLGIGESKEISFMPTK 119

  Fly   139 QSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAG 203
            .:.:|.|..:|:.....|| ||:.......|..|.:|       ......||..:..|.|:..:.
  Rat   120 INSLAGIKIIQVSCGHYHS-LALSEDGQVFSWGSNRQ-------GQLGLGNNLCSQASPQKVKSL 176

  Fly   204 PTFPENSAQEFPSGAPASSAIDLDAMNTCM------SQDIPMSMQTVHKKQRSYDVISPIQLNRQ 262
            ...|   ..:..:|...|.|:.|  |.|..      |..:.:|..:.  |::.|...|       
  Rat   177 EGIP---LAQVAAGGTHSFALSL--MGTSFGWGNNRSGQLALSGNSA--KEQIYKPHS------- 227

  Fly   263 LGALPP--------GWEQAK--TNDGQIYYLNHTTKSTQWEDPR 296
            :|||..        |:|...  |.|||::....::.......||
  Rat   228 IGALKTLNVVYISCGYEHTSVLTEDGQVFTFGGSSSEQLQHSPR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 11/46 (24%)
WW 266..295 CDD:395320 7/38 (18%)
WW 335..364 CDD:395320
Herc6XP_008761185.1 RCC1 39..88 CDD:278826 7/32 (22%)
RCC1 92..141 CDD:278826 14/49 (29%)
RCC1 144..194 CDD:278826 10/59 (17%)
RCC1_2 182..210 CDD:290274 7/29 (24%)
RCC1_2 236..265 CDD:290274 6/28 (21%)
RCC1 252..299 CDD:278826 5/20 (25%)
HECTc 682..1023 CDD:238033
HECTc 706..1023 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.