DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Su(dx)

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001259898.1 Gene:Su(dx) / 33379 FlyBaseID:FBgn0003557 Length:949 Species:Drosophila melanogaster


Alignment Length:431 Identity:110/431 - (25%)
Similarity:159/431 - (36%) Gaps:137/431 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CSFRLYTISAFYMLTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVVRVN--------------- 61
            |.|...||..|  :|:.|.:..|                 ||..||..:|               
  Fly   143 CEFLELTIDLF--VTSKSDNRQT-----------------KSGELVAILNGLKLDMSKLQIQPVA 188

  Fly    62 --QDTDDNLQALFDSVLNPGDAKRP------LQLPLRMRK-------------LPNSFFTPPAPS 105
              |:.:..:||:..||::...|.|.      ::..:|:|.             |||.     ...
  Fly   189 GQQNGNPPVQAVNPSVVSDAAAGRSCMIYGGVRARMRLRSSSGNSNGGETRSPLPNG-----GGD 248

  Fly   106 HSRANSADSTYDAGSQSSINIGNKASIVQQP----DGQSPIAAIPQLQIQPSPQHSRLAIHHSRA 166
            |.|:..|...::...|.|.|       .|||    :|..  ||:|  |..|.||..         
  Fly   249 HRRSTQAPPVWEQQQQQSQN-------QQQPLRMVNGSG--AAVP--QTAPYPQQP--------- 293

  Fly   167 RSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNT 231
             .:||.      .|..:....|...|..|::...|||     ..|...|.|. |...|:...:..
  Fly   294 -PAPAL------ARPLTQVYGALPENTQPAAVYLPAG-----GGAAVGPPGV-AGPPIEQPGVGL 345

  Fly   232 CMSQDIPMSMQTVHKKQRSYDVISP----IQLNRQLG------------------ALPPGWEQAK 274
            .:||.....:||    |.:.|...|    |:|: |.|                  .||||||..|
  Fly   346 PVSQSTDPQLQT----QPADDEPLPAGWEIRLD-QYGRRYYVDHNTRSTYWEKPTPLPPGWEIRK 405

  Fly   275 TNDGQIYYLNHTTKSTQWEDP------RIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIA---- 329
            ...|::||::|.|:.|.|:.|      ..|:.|.|:..:..:..|..:....:|..|:..|    
  Fly   406 DGRGRVYYVDHNTRKTTWQRPNSERLMHFQHWQGQRAHVVSQGNQRYLYSQQQQQPTAVTAQVTQ 470

  Fly   330 ---NNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
               :.|||||||||:.:.....:||:||.:|||.|.|||.|
  Fly   471 DDEDALGPLPDGWEKKIQSDNRVYFVNHKNRTTQWEDPRTQ 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 45/138 (33%)
WW 266..295 CDD:395320 14/28 (50%)
WW 335..364 CDD:395320 14/28 (50%)
Su(dx)NP_001259898.1 C2_E3_ubiquitin_ligase 48..173 CDD:175988 12/48 (25%)
WW 364..396 CDD:197736 5/32 (16%)
WW 397..426 CDD:278809 14/28 (50%)
WW 478..509 CDD:197736 16/30 (53%)
WW 522..554 CDD:197736
HECTc 594..946 CDD:238033
HECTc 620..946 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.