DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and CG4238

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:155 Identity:28/155 - (18%)
Similarity:68/155 - (43%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 QIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVL-----QTTKQTTTSTIANNLGPLPDG 338
            :::|     |..:.:||.: |..:.:.::...:...|.|     :....:::..::..:..:|:|
  Fly   743 RVHY-----KYFEQDDPDL-YLSKIKYILDTDLDATDTLELYFVEEMYDSSSGQLSKTIELIPNG 801

  Fly   339 WEQAVTESGDLYFINHIDRTTSWNDPRMQ-----SGLSVLDCPDNLVSSL---QIEDNLCSN--- 392
            .:..||.:....:::.:.:....|:.:.:     .||:.: .||||:|..   ::|..:|..   
  Fly   802 AKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSI-IPDNLLSIFDENELELLMCGTGEY 865

  Fly   393 LFNDAQA--IVNPPSSHKPDDLEWY 415
            ..:|.:|  |.|..|:.....|.|:
  Fly   866 SISDFKAHHIANGNSAEFRRVLAWF 890

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 25/142 (18%)
WW 266..295 CDD:395320 2/15 (13%)
WW 335..364 CDD:395320 5/28 (18%)
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 28/155 (18%)
HECTc 642..974 CDD:214523 28/155 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.