DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Wwc1

DIOPT Version :10

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001414291.1 Gene:Wwc1 / 303039 RGDID:1308329 Length:1108 Species:Rattus norvegicus


Alignment Length:103 Identity:38/103 - (36%)
Similarity:55/103 - (53%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||.|||:|:..||::||::|..::|.|.|||.:|                    ||..|.:...:
  Rat     8 LPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRY--------------------TKPLTFADCIS 52

  Fly   331 NLGPLPDGWEQAV-TESGDLYFINHIDRTTSWNDPRMQ 367
            :  .||.|||:|. .:.|| |||:|..:||...|||:|
  Rat    53 D--ELPLGWEEAYDPQVGD-YFIDHNTKTTQIEDPRVQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 38/103 (37%)
WW 266..295 CDD:459800 13/28 (46%)
WW 335..364 CDD:459800 14/29 (48%)
Wwc1NP_001414291.1 WW 8..37 CDD:459800 13/28 (46%)
WW 56..85 CDD:238122 14/29 (48%)
SMC_prok_B <162..>422 CDD:274008
COG4913 <311..>422 CDD:443941
C2_Kibra 661..784 CDD:176062
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.