DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Wwp1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006237992.1 Gene:Wwp1 / 297930 RGDID:1311734 Length:968 Species:Rattus norvegicus


Alignment Length:320 Identity:82/320 - (25%)
Similarity:122/320 - (38%) Gaps:81/320 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANS----ADSTYDAG----SQSSINIGN-KASIV 133
            |..|.||...|     .|....:.|........|    ||||...|    |:.|.:..| .::.|
  Rat   268 PQVATRPQNTP-----APKPLTSEPTSDTVNGESSSVLADSTSAMGTSLPSEDSTSTSNCTSTTV 327

  Fly   134 QQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARS----DAAAANNPN-- 192
            |:|..|.|.|         |.:||. .|..:.|...|         .|||    |:.:.||..  
  Rat   328 QEPPVQEPPA---------SSEHSE-CIPSASAEVGP---------EARSLIDPDSDSRNNSGFD 373

  Fly   193 --ANPSSQQQPAGPTFPENSAQEFPSG-----APASSA--IDLDAMNTCMSQDIPMSMQTVHKKQ 248
              ..|....:|..|.....:.:..|||     .|....  :|.:...|...:..|          
  Rat   374 KVRQPEGCVEPLRPQSGNTNTESLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQP---------- 428

  Fly   249 RSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQ 313
                             ||||||:...:.|::||::|.|::|.|:.|.::..:..:...::|.:.
  Rat   429 -----------------LPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNFEQWQSQRNQL 476

  Fly   314 NDVLQTTKQ----TTTSTIANN--LGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
            ...:|...|    :.:...|.|  .||||.|||:.|..:..:||:||..:||.|.|||.|
  Rat   477 QGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTKTTQWEDPRTQ 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 38/113 (34%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 13/28 (46%)
Wwp1XP_006237992.1 C2_E3_ubiquitin_ligase 67..190 CDD:175988
PARM 243..>400 CDD:293666 38/155 (25%)
WW 397..426 CDD:278809 6/28 (21%)
WW 429..458 CDD:278809 13/28 (46%)
WW 504..533 CDD:278809 13/28 (46%)
WW 545..574 CDD:238122
HECTc 614..966 CDD:238033
HECTc 637..965 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.