DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Bag3

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:46 Identity:19/46 - (41%)
Similarity:30/46 - (65%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 QTTTSTIANNLGPLPDGWEQAV-TESGDLYFINHIDRTTSWNDPRM 366
            |..:...|::..|||.|||..: .::|..:|::|..|||:|||||:
  Rat    11 QMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRV 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 19/46 (41%)
WW 266..295 CDD:395320
WW 335..364 CDD:395320 13/29 (45%)
Bag3NP_001011936.1 WW 23..55 CDD:197736 15/31 (48%)
BAG 423..500 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.