DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Bag3

DIOPT Version :10

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:46 Identity:19/46 - (41%)
Similarity:30/46 - (65%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 QTTTSTIANNLGPLPDGWEQAV-TESGDLYFINHIDRTTSWNDPRM 366
            |..:...|::..|||.|||..: .::|..:|::|..|||:|||||:
  Rat    11 QMASGNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRV 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 19/46 (41%)
WW 266..295 CDD:459800
WW 335..364 CDD:459800 13/29 (45%)
Bag3NP_001011936.1 WW 23..55 CDD:197736 15/31 (48%)
PRK12323 <260..>372 CDD:481241
BAG 423..500 CDD:214591
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.