DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Wwp2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001099654.1 Gene:Wwp2 / 291999 RGDID:1310091 Length:870 Species:Rattus norvegicus


Alignment Length:350 Identity:93/350 - (26%)
Similarity:142/350 - (40%) Gaps:44/350 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFF 99
            |:.:...:..|:..|.:....|.:.::..|.|     ..||.|........|.|.|     .|..
  Rat   116 NTQLTLNLQTENKGSVVSGGELTIFLDGPTVD-----LGSVPNGSAVTDGSQPPSR-----ESSG 170

  Fly   100 TPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLA---- 160
            |..||.......:.:.:...|::..:.|..|........|||.|.....|...:|..|.||    
  Rat   171 TALAPETRHQPPSTNCFGGRSRTHRHSGGSARTATATGEQSPGARNRHRQPVKNPSSSGLANGTV 235

  Fly   161 IHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPE------NSAQEFPSGAP 219
            .......|.|..|..   |...|..|||::.:.||::...||..|..|      :..|:.|:.|.
  Rat   236 SEEPTTASDPEELSV---VGVTSPPAAASSVSPNPNTTSLPAPSTPAEGEEPSTSGTQQLPAAAQ 297

  Fly   220 ASSAIDLDAMNTCMSQ-DIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYL 283
            |.     ||:.....| .:|        ..|.|.|....:.......||||||:.....|:.||:
  Rat   298 AP-----DALPAGWEQRQLP--------NGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYV 349

  Fly   284 NHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQ------TTTSTIANNLGPLPDGWEQA 342
            :|.|::|.|:.|..:|.:..:...::|.:....:|...|      ::.||..:.|||||.|||:.
  Rat   350 DHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKR 414

  Fly   343 VTESGDLYFINHIDRTTSWNDPRMQ 367
             .::|.:|::||..|||.|.|||.|
  Rat   415 -QDNGRVYYVNHNTRTTQWEDPRTQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 39/112 (35%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 13/28 (46%)
Wwp2NP_001099654.1 C2_E3_ubiquitin_ligase 17..142 CDD:175988 4/25 (16%)
WW 302..331 CDD:278809 5/36 (14%)
WW 332..361 CDD:278809 13/28 (46%)
WW 407..435 CDD:278809 13/28 (46%)
WW 447..477 CDD:238122
HECTc 516..868 CDD:238033
HECTc 539..867 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.