DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HECTD1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_056197.3 Gene:HECTD1 / 25831 HGNCID:20157 Length:2610 Species:Homo sapiens


Alignment Length:340 Identity:69/340 - (20%)
Similarity:126/340 - (37%) Gaps:57/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 APSHSRANSADSTYDAGSQSSINIGN-----------KASIVQQPDGQSPIAA------IPQLQI 150
            |.|.||..|:.|.....|.|.|::|:           :.|||...|...||..      :||.::
Human  1376 AGSSSRKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAENVPQTEV 1440

  Fly   151 QPSPQHSRLAI-HHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEF 214
            ..|...|...: ..:.:.::...|..:.:||...:::|.:....:.||   |...:..|.:.:|.
Human  1441 GSSSSASTSTLTAETGSENAERKLGPDSSVRTPGESSAISMGIVSVSS---PDVSSVSELTNKEA 1502

  Fly   215 PSGAP-ASSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTN-- 276
            .|..| :|||.:..::::.::...|||.........|.:..|.....|::..:      |:||  
Human  1503 ASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANI------ARTNAT 1561

  Fly   277 ----------DGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANN 331
                      |.....|.....||....  :...|....|..........:.|:..|::|.:|..
Human  1562 NNMNLSRSSSDNNTNTLGRNVMSTATSP--LMGAQSFPNLTTPGTTSTVTMSTSSVTSSSNVATA 1624

  Fly   332 LGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDNLCSNLFND 396
            ...|..|  |:::.:    ....:..|:|.:|...::..|:.|..|:..:|     .|.:.|.:|
Human  1625 TTVLSVG--QSLSNT----LTTSLTSTSSESDTGQEAEYSLYDFLDSCRAS-----TLLAELDDD 1678

  Fly   397 AQAIVNPPSSHKPDD 411
            ...    |...:.||
Human  1679 EDL----PEPDEEDD 1689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 27/154 (18%)
WW 266..295 CDD:395320 7/40 (18%)
WW 335..364 CDD:395320 5/28 (18%)
HECTD1NP_056197.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..269
Ank_2 366..457 CDD:403870
ANK repeat 366..393 CDD:293786
ANK 1 395..424
ANK repeat 396..426 CDD:293786
ANK 2 426..455
ANK repeat 428..457 CDD:293786
ANK 3 459..491
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..513
ANK 4 579..612
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 627..657
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 707..748
Sad1_UNC 1107..1240 CDD:400199
MIB_HERC2 1277..1335 CDD:399589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1343..1406 10/29 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1433..1483 8/49 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1496..1515 7/18 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1592..1611 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1674..1757 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1777..1797
BTHB 1892..1965 CDD:408209
K-box 2029..2103
HECTc 2131..2608 CDD:238033
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2297..2318
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.