DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Plekha7

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_017177675.1 Gene:Plekha7 / 233765 MGIID:2445094 Length:1359 Species:Mus musculus


Alignment Length:99 Identity:25/99 - (25%)
Similarity:42/99 - (42%) Gaps:24/99 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||..|......||:::::|...:.|.|..||          ..|.:....::::           
Mouse    10 LPEHWSYGVCRDGRVFFINDQLRCTTWLHPR----------TGEPVNSGHMIRS----------- 53

  Fly   331 NLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDP 364
               .||.|||:..||.|..:||:|..:||::..|
Mouse    54 ---DLPRGWEEGFTEEGASFFIDHNQQTTTFRHP 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 25/99 (25%)
WW 266..295 CDD:395320 8/28 (29%)
WW 335..364 CDD:395320 13/28 (46%)
Plekha7XP_017177675.1 WW 10..39 CDD:366073 8/28 (29%)
WW 55..84 CDD:366073 13/28 (46%)
PH_PEPP1_2_3 158..280 CDD:270068
Smc <692..>894 CDD:224117
PHA03247 <903..1009 CDD:223021
PRK10263 <912..>1118 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.