DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and NEDD4L

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006722489.1 Gene:NEDD4L / 23327 HGNCID:7728 Length:1019 Species:Homo sapiens


Alignment Length:341 Identity:75/341 - (21%)
Similarity:129/341 - (37%) Gaps:63/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SPIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAPSHSRANSAD 113
            ||.:.:..:.|..|.|.|:....|.|::....:.|.....:...........||:....||.|  
Human   329 SPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPAGRARS-- 391

  Fly   114 STYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYN 178
            ||...|.:.:.::....:....|.|..        :.:.:...:....|::|..:....:.|...
Human   392 STVTGGEEPTPSVAYVHTTPGLPSGWE--------ERKDAKGRTYYVNHNNRTTTWTRPIMQLAE 448

  Fly   179 VRARSDAAAANNPNANPSSQ--QQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPM-S 240
            ..|...|..:||....|..:  :..:.||...::..|....:|...|:.....|....|..|. |
Human   449 DGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNS 513

  Fly   241 MQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQI 305
            .:..||..:|:              ||||||.....:|:.::::|.||:|.|||||:::      
Human   514 PKPQHKVTQSF--------------LPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKF------ 558

  Fly   306 LMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHI--------------- 355
                        ....::.||...|:|||||.|||:.:...|..::|:|.               
Human   559 ------------PVHMRSKTSLNPNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTRESVP 611

  Fly   356 ---DRTTSWNDPRMQS 368
               .:.|.|.|||:|:
Human   612 SYDSKITQWEDPRLQN 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 36/126 (29%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/46 (22%)
NEDD4LXP_006722489.1 C2_NEDD4_NEDD4L 21..179 CDD:175999
WW 224..250 CDD:278809
WW 413..442 CDD:278809 4/36 (11%)
WW 526..556 CDD:238122 14/29 (48%)
WW 575..625 CDD:197736 13/49 (27%)
HECTc 662..1016 CDD:238033
HECTc 686..1015 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.