DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and HECW1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_016867371.1 Gene:HECW1 / 23072 HGNCID:22195 Length:1639 Species:Homo sapiens


Alignment Length:401 Identity:70/401 - (17%)
Similarity:111/401 - (27%) Gaps:195/401 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SHSRANSADSTYDA-----GSQSSINIGNKASIVQQPDG-QSPIAAIPQLQIQP------SPQHS 157
            ||:|.:|.||...:     .||......|.| ....||. |||       ::.|      .|...
Human   748 SHTRFSSVDSAKISESTVFSSQDDEEEENSA-FESVPDSMQSP-------ELDPESTNGAGPWQD 804

  Fly   158 RLAIHHSRARSSPASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFPENS--AQEFPSGAPA 220
            .||........||..|:               :|.|.||::::...|.. .||  ..:.||..| 
Human   805 ELAAPSGHVERSPEGLE---------------SPVAGPSNRREGECPIL-HNSQPVSQLPSLRP- 852

  Fly   221 SSAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNH 285
                                      :...|..|..        .|||.||....:.|:::|::|
Human   853 --------------------------EHHHYPTIDE--------PLPPNWEARIDSHGRVFYVDH 883

  Fly   286 TTKSTQWEDPRI---------------------QYRQQQQILMAERIKQNDVLQTTKQT------ 323
            ..::|.|:.|..                     :|:..|:.:..||.:::...|:.:|.      
Human   884 VNRTTTWQRPTAAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEEDSGSQSCEQAPAGGGG 948

  Fly   324 --------------------------------------------------------------TTS 326
                                                                          |:|
Human   949 GGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFITNPEFFTVLHANYSAYRVFTSS 1013

  Fly   327 T-------------------------------IANNLGPLPDGWEQAVTESGDLYFINHIDRTTS 360
            |                               .|:....||.|||....:.|..:|::|..|.|:
Human  1014 TCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIKTDQQGKSFFVDHNSRATT 1078

  Fly   361 WNDPR--MQSG 369
            :.|||  :|:|
Human  1079 FIDPRIPLQNG 1089

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 36/231 (16%)
WW 266..295 CDD:395320 10/28 (36%)
WW 335..364 CDD:395320 10/28 (36%)
HECW1XP_016867371.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.