DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yki and Wwc1

DIOPT Version :9

Sequence 1:	NP_001350857.1	Gene:	yki / 37851	FlyBaseID:	FBgn0034970	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_740749.1	Gene:	Wwc1 / 211652	MGIID:	2388637	Length:	1104	Species:	Mus musculus

Alignment Length:	103	Identity:	38/103 - (36%)
Similarity:	55/103 - (53%)	Gaps:	24/103 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||.|||:|:..||::||::|..::|.|.|||.:|                    ||..|.:...:
Mouse     8 LPEGWEEARDFDGKVYYIDHRNRTTSWIDPRDRY--------------------TKPLTFADCIS 52

  Fly   331 NLGPLPDGWEQAV-TESGDLYFINHIDRTTSWNDPRMQ 367
            :  .||.|||:|. .:.|| |||:|..:||...|||:|
Mouse    53 D--ELPLGWEEAYDPQVGD-YFIDHNTKTTQIEDPRVQ 87

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yki	NP_001350857.1	HUL4	<261..>404	CDD:227354	38/103 (37%)
		WW	266..295	CDD:395320	13/28 (46%)
		WW	335..364	CDD:395320	14/29 (48%)
Wwc1	NP_740749.1	WW	9..39	CDD:238122	14/29 (48%)
		WW	55..84	CDD:278809	14/29 (48%)
		ALDH-SF	378..>420	CDD:299846
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	429..449
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	509..547
		C2_Kibra	661..784	CDD:176062
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	822..949
		Interaction with histone H3. /evidence=ECO:0000250	836..1104
		Interaction with PRKCZ. /evidence=ECO:0000250	945..988
		ADDV motif	1102..1104
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900