DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and yap-1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001369894.1 Gene:yap-1 / 181267 WormBaseID:WBGene00008748 Length:442 Species:Caenorhabditis elegans


Alignment Length:288 Identity:67/288 - (23%)
Similarity:104/288 - (36%) Gaps:80/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NNLVVRVNQDTDDNLQALFDS-----VLNPGDAKRPLQLPLRMRKLPNSFF----TPPAPSHSRA 109
            |...|....|.:.::.||...     ..|....|.|         ||:|::    .|.:.:||..
 Worm    19 NQFSVHHYLDPNQSIHALISCSEKKYEKNQNQKKNP---------LPSSYYHQKRNPGSSAHSPY 74

  Fly   110 NSAD-STYDAGSQSSINIGNKASI----VQQP-------DGQSPIAAIPQLQIQPSPQHSRLAIH 162
            .|.| |:..|.|.:...:.|:|.|    |..|       :|||....       |.|.|..  :|
 Worm    75 GSVDESSRTAVSPAMDMVSNQAPIHTRQVSAPNLHTSVNNGQSSATV-------PHPSHHN--VH 130

  Fly   163 HSRARS-SPASLQQNY-----NVRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPAS 221
            |..::| |...:...|     :|::.|..|..:....:...|||.......|.|....|...|..
 Worm   131 HQHSKSVSALPMTIGYSPVPSHVKSVSHEANYSYAGLSEIPQQQGMMQQNREKSLSLDPMRRPFM 195

  Fly   222 SAIDLDAMNTCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHT 286
            :..|:        :.:||                           |.|||....:||..|:.:|.
 Worm   196 TPQDV--------EQLPM---------------------------PQGWEMCYDSDGVRYFKDHN 225

  Fly   287 TKSTQWEDPRIQYRQQQQILMAERIKQN 314
            :|:|.|:|||::.::|....:.|.|.||
 Worm   226 SKTTTWDDPRLKQQEQTGFGLGENIGQN 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 19/54 (35%)
WW 266..295 CDD:395320 11/28 (39%)
WW 335..364 CDD:395320
yap-1NP_001369894.1 WW 206..236 CDD:238122 13/29 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166556
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR17616
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.