DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Nedd4

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001344927.1 Gene:Nedd4 / 17999 MGIID:97297 Length:1207 Species:Mus musculus


Alignment Length:344 Identity:84/344 - (24%)
Similarity:137/344 - (39%) Gaps:83/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DSVLNPGDAKRPLQ--LPLRMRKLPNSFFTPPAPSHSRANSADSTYDAGSQSSINIGNKASIVQQ 135
            |.||:|...|..::  |.|:|..||.:            .|.|...|...:    :.....::.|
Mouse   507 DFVLHPRSHKSRVKGYLRLKMTYLPKN------------GSEDENADQAEE----LEPGWVVLDQ 555

  Fly   136 PDGQSPIAAIPQLQIQPSPQHSRLAI--------HHSR----ARSSP---ASLQQNYNVRARSDA 185
            ||..:.:...|:....|.....|..:        |.||    .|.||   .:.:.|.:::.::..
Mouse   556 PDAATHLPHPPEPSPLPPGWEERQDVLGRTYYVNHESRRTQWKRPSPDDDLTDEDNDDMQLQAQR 620

  Fly   186 AAANNPNAN-----PSSQQQPAG-PTFPENSAQEFPSGA---PASSAIDLDAM------------ 229
            |.......:     |.:::.|.. ....|:...|:...|   |.|..||:...            
Mouse   621 AFTTRRQISEDVDGPDNRESPENWEIVREDENTEYSGQAVQSPPSGHIDVQTHLAEEFNTRLAVC 685

  Fly   230 -NTCMSQDIPM--------SMQT-VHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLN 284
             |...||.:..        |:|| :.::|.:..|:.|..     ..||||||:.:.:.|:.||::
Mouse   686 GNPATSQPVTSSNHSSRGGSLQTCIFEEQPTLPVLLPTS-----SGLPPGWEEKQDDRGRSYYVD 745

  Fly   285 HTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDL 349
            |.:|:|.|..|.:|...:.:|....|.|              |.:|:|||||.|||:.....|.:
Mouse   746 HNSKTTTWSKPTMQDDPRSKIPAHLRGK--------------TDSNDLGPLPPGWEERTHTDGRV 796

  Fly   350 YFINHIDRTTSWNDPRMQS 368
            :||||..:.|.|.|||:|:
Mouse   797 FFINHNIKKTQWEDPRLQN 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 39/108 (36%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 12/28 (43%)
Nedd4NP_001344927.1 C2 <477..530 CDD:326325 8/22 (36%)
WW 574..602 CDD:238122 5/27 (19%)
WW 727..756 CDD:306827 13/28 (46%)
WW 781..813 CDD:197736 15/31 (48%)
HECTc 874..1203 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.