DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and magi-1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001255577.1 Gene:magi-1 / 178107 WormBaseID:WBGene00010444 Length:1054 Species:Caenorhabditis elegans


Alignment Length:152 Identity:41/152 - (26%)
Similarity:58/152 - (38%) Gaps:45/152 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTI 328
            |.|||.||.|.|.:|..|:::|.|.:|.|:|||                                
 Worm   260 GLLPPNWETAYTENGDKYFIDHNTGTTTWDDPR-------------------------------- 292

  Fly   329 ANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLS-VLDCP---DNLVSSLQIEDNL 389
                 .||.||||...::...::::||:|.|.:..|....|.| .:|.|   ..|.||.....|.
 Worm   293 -----ELPPGWEQVDDQNYGTFYVDHINRKTQYERPYGFGGSSATIDQPVKYGTLPSSTNHNHNN 352

  Fly   390 CSNLFNDAQAIVNPPSSHKPDD 411
            ..:.:|....    .||..|.|
 Worm   353 IYSHYNSGTL----KSSSSPRD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 37/143 (26%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
magi-1NP_001255577.1 NK 180..>244 CDD:302627
WW 263..293 CDD:238122 15/66 (23%)
WW 294..323 CDD:278809 10/28 (36%)
PDZ 421..510 CDD:214570
PDZ_signaling 535..600 CDD:238492
PDZ_signaling 717..800 CDD:238492
PDZ_signaling 822..902 CDD:238492
PDZ_signaling 968..1049 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.