DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Y92H12A.2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001293292.1 Gene:Y92H12A.2 / 171719 WormBaseID:WBGene00022358 Length:724 Species:Caenorhabditis elegans


Alignment Length:333 Identity:78/333 - (23%)
Similarity:123/333 - (36%) Gaps:85/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LVVRVNQDTDDNLQALFDSVLNPG----DAKRPLQLPLRM------RKLPNSFFT-PPAPSHSRA 109
            ||...|:...|.|.......||.|    .|..|.:..|:.      :.:.:.|.: ...||.|..
 Worm    89 LVYDENRLRKDVLMGFVSRTLNDGLITTQAPNPEEYALQSGTASKGKSIGSLFLSFHFMPSSSDN 153

  Fly   110 NSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHS--RARSSPAS 172
            :.:|||.|....||   |......::.||..                ..:.::|:  ..:.:|..
 Worm   154 SPSDSTADLQQTSS---GMPQGWEEREDGNG----------------RTVYVNHALRTTQFTPPE 199

  Fly   173 LQQNYNVRARSDAAA-----ANNPNANPSSQ--QQPAGPTFPENSAQEFPSGAPASSAIDLDAMN 230
            ...|.||.|.::.:.     ....|....||  .:|:..|...|..          :||| |||.
 Worm   200 SVSNGNVDAITEQSVIEETRRRRDNYEHRSQVTDEPSDTTIVSNEL----------TAID-DAMR 253

  Fly   231 TCMSQDIPMSMQTVHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDP 295
            ....:.      ..|.::...::           .||.||:.....:|:.::::|.||:|.|.||
 Worm   254 ANFERG------GGHVEEEEDEL-----------RLPDGWDMQVAPNGRTFFIDHRTKTTTWTDP 301

  Fly   296 RIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTS 360
            |.....:..:|   |.|.:|               .:|.||.||||.|...|.::||:|..|.|.
 Worm   302 RPGAATRVPLL---RGKTDD---------------EIGALPAGWEQRVHADGRVFFIDHNRRRTQ 348

  Fly   361 WNDPRMQS 368
            |.|||.::
 Worm   349 WEDPRFEN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 35/108 (32%)
WW 266..295 CDD:395320 10/28 (36%)
WW 335..364 CDD:395320 14/28 (50%)
Y92H12A.2NP_001293292.1 C2 20..147 CDD:301316 12/57 (21%)
WW 170..198 CDD:278809 3/43 (7%)
WW 272..301 CDD:278809 10/28 (36%)
WW 323..353 CDD:197736 15/29 (52%)
HECTc 393..721 CDD:238033
HECTc 415..720 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.