DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and herc-1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_490834.1 Gene:herc-1 / 171700 WormBaseID:WBGene00021685 Length:1019 Species:Caenorhabditis elegans


Alignment Length:152 Identity:31/152 - (20%)
Similarity:51/152 - (33%) Gaps:33/152 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 HSRANSADSTYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSP 170
            |:.|....:.|..|..||..:||                 .::..|.:|:.:....|   .....
 Worm   306 HTIAICKGAPYPFGLNSSGQLGN-----------------GKIMTQSTPRKTDELDH---VTGVF 350

  Fly   171 ASLQQNYNVRARSDAAAANNPNANPSSQQQPAGPTFP----ENSAQEFPSGAPASSAIDLDAMNT 231
            |...|.:.|  ||......|....||...|     :|    ..|.::......|...:.|  :.:
 Worm   351 AGYHQTFFV--RSSGTIEQNEIVGPSCPMQ-----YPIKLDHESLKKLLDEGDALEVMSL--IES 406

  Fly   232 CMSQDIPMSMQTVHKKQRSYDV 253
            ..|....|:|..::|.:|.|:|
 Worm   407 VFSSLASMNMSFLYKDERRYNV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
herc-1NP_490834.1 ATS1 2..359 CDD:227511 13/72 (18%)
HECTc 667..1016 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.