DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Trip12

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_011236956.1 Gene:Trip12 / 14897 MGIID:1309481 Length:2074 Species:Mus musculus


Alignment Length:234 Identity:53/234 - (22%)
Similarity:82/234 - (35%) Gaps:74/234 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LTTMSASSNTNSLIEKEIDDEDMLSPIKSNNLVV----RVNQDTDDNLQALFDSVLNP------- 78
            :|..|::::|:|          ..|.|.|.:..|    ||.|..|.|......|..:|       
Mouse   235 ITDSSSAASTSS----------SSSAIASASSTVPAGARVKQGKDQNKARRSRSASSPSPRRSSR 289

  Fly    79 --------GDAK--------RPLQLPLRMRKLPNSF---FTPPAPSHSRANSADSTYDAGSQSSI 124
                    |.:|        ..:.||.....||.|.   .:.|.||..:|..|........:|  
Mouse   290 EKEQSKTGGSSKFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLASLRKSTKKRS-- 352

  Fly   125 NIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAAAAN 189
                          :||.|.:|.|:     :.:|     .:...|.||..:..:...:..||.|.
Mouse   353 --------------ESPPAELPSLR-----RSTR-----QKTTGSCASTSRRGSGLGKRGAAEAR 393

  Fly   190 NPN--ANPSSQQQPAGPTFPENSAQ--EFPSGAPASSAI 224
            ...  |:|.|.|:    |...::|:  |.|.||.|||::
Mouse   394 RQEKMADPESNQE----TVNSSAARTDEAPQGAAASSSV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354
WW 266..295 CDD:395320
WW 335..364 CDD:395320
Trip12XP_011236956.1 SRP1 489..>714 CDD:227396
WWE 814..876 CDD:397111
HECTc 1672..2072 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.