DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Gas7

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:273 Identity:57/273 - (20%)
Similarity:86/273 - (31%) Gaps:89/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRARSDAA 186
            |.:.:..|..:|..|.|:.     .|..|.|...||.|         ||..  :.|.|...::..
Mouse    55 SYVQLLEKPGMVPPPPGEE-----SQTVILPPGWHSYL---------SPQG--RRYYVNTTTNET 103

  Fly   187 AANNPNANPSSQQQPAGP---TFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQTVHKKQ 248
            ....|:::|.....| ||   :.|........||.||...                  :|.|...
Mouse   104 TWERPSSSPGISASP-GPHRSSLPTTVNGYHASGTPAHPP------------------ETAHMSL 149

  Fly   249 RSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTT-------------KSTQW-------- 292
            |.....|     :.||:..||.:|:|.|   ...:|..|             |.|:|        
Mouse   150 RKSTGDS-----QNLGSSSPGRKQSKEN---TITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWA 206

  Fly   293 --EDP---------------RIQYRQQQQIL---MAERIK--QNDVLQTTKQTTTSTIANNLGPL 335
              :||               :::.:|.|:.:   :.||||  :.......|.:..|..|...|.|
Mouse   207 DKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQNSLAAQEEGSL 271

  Fly   336 PDGWEQAVTESGD 348
            .:.|.|......|
Mouse   272 GEAWAQVKKSLAD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 28/131 (21%)
WW 266..295 CDD:395320 10/51 (20%)
WW 335..364 CDD:395320 4/14 (29%)
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763 1/1 (100%)
WW_FCH_linker 109..201 CDD:374680 25/118 (21%)
F-BAR_GAS7 214..446 CDD:153333 14/71 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.