DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment yki and PLEKHA7

DIOPT Version :9

Sequence 1:	NP_001350857.1	Gene:	yki / 37851	FlyBaseID:	FBgn0034970	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	XP_024304124.1	Gene:	PLEKHA7 / 144100	HGNCID:	27049	Length:	1365	Species:	Homo sapiens

Alignment Length:	123	Identity:	32/123 - (26%)
Similarity:	51/123 - (41%)	Gaps:	29/123 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||..|......||:::::|...:.|.|..||          ..|.:....::::
Human    11 LPEHWSYGVCRDGRVFFINDQLRCTTWLHPR----------TGEPVNSGHMIRS----------- 54

  Fly   331 NLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQSGLSVLDCPDNLVSSLQIEDN 388
               .||.|||:..||.|..|||:|..:||::..|     ::....|:|....||.|.|
Human    55 ---DLPRGWEEGFTEEGASYFIDHNQQTTAFRHP-----VTGQFSPENSEFILQEEPN 104

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
yki	NP_001350857.1	HUL4	<261..>404	CDD:227354	32/123 (26%)
		WW	266..295	CDD:395320	8/28 (29%)
		WW	335..364	CDD:395320	14/28 (50%)
PLEKHA7	XP_024304124.1	WW	11..40	CDD:306827	8/28 (29%)
		WW	56..85	CDD:306827	14/28 (50%)
		PH_PEPP1_2_3	159..281	CDD:270068
		NESP55	<299..460	CDD:115071
		DUF1640	779..905	CDD:311647
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900