Sequence 1: | NP_001350857.1 | Gene: | yki / 37851 | FlyBaseID: | FBgn0034970 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446073.2 | Gene: | Magi2 / 113970 | RGDID: | 621855 | Length: | 1277 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 54/203 - (26%) |
---|---|---|---|
Similarity: | 84/203 - (41%) | Gaps: | 49/203 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 191 PNANPSSQ-----------QQPAGPTFPENSAQEFP----SG---APASSAID---LDAMNTCMS 234
Fly 235 QDIPMSM--QTVHKKQRSYDVIS--PIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDP 295
Fly 296 RIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTS 360
Fly 361 WNDPRMQS 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yki | NP_001350857.1 | HUL4 | <261..>404 | CDD:227354 | 31/108 (29%) |
WW | 266..295 | CDD:395320 | 13/28 (46%) | ||
WW | 335..364 | CDD:395320 | 10/28 (36%) | ||
Magi2 | NP_446073.2 | PDZ_signaling | 22..96 | CDD:238492 | |
GuKc | 118..291 | CDD:214504 | 20/85 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 205..308 | 25/103 (24%) | |||
Interaction with DDN. /evidence=ECO:0000250 | 302..381 | 31/101 (31%) | |||
WW | 304..333 | CDD:395320 | 13/28 (46%) | ||
WW | 350..381 | CDD:197736 | 11/30 (37%) | ||
PDZ | 428..509 | CDD:214570 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 556..575 | ||||
PDZ | 602..683 | CDD:214570 | |||
MAGI_u5 | 687..758 | CDD:406953 | |||
PDZ | 775..861 | CDD:214570 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 869..913 | ||||
PDZ_signaling | 920..1007 | CDD:238492 | |||
PRK10263 | <1007..>1135 | CDD:236669 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1011..1130 | ||||
PDZ_signaling | 1140..1220 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |