DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and Magi2

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_446073.2 Gene:Magi2 / 113970 RGDID:621855 Length:1277 Species:Rattus norvegicus


Alignment Length:203 Identity:54/203 - (26%)
Similarity:84/203 - (41%) Gaps:49/203 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PNANPSSQ-----------QQPAGPTFPENSAQEFP----SG---APASSAID---LDAMNTCMS 234
            |.|.||::           .:.|....||...:|.|    :|   .|.||..:   ..|.....|
  Rat   205 PGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEERPVVNGNGVVITPESSEHEDKSAGASGETPS 269

  Fly   235 QDIPMSM--QTVHKKQRSYDVIS--PIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDP 295
            |..|..:  |....|.:..|..|  | :.|.....||..||.|.|..|::|:::|.||:|.|.||
  Rat   270 QPYPAPVYSQPEELKDQMDDTKSTKP-EENEDSDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDP 333

  Fly   296 RIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTS 360
            |:..:.:.    ||..|:|:                   ||.|||:........|:::||:|.|.
  Rat   334 RLAKKAKP----AEECKENE-------------------LPYGWEKIDDPIYGTYYVDHINRRTQ 375

  Fly   361 WNDPRMQS 368
            :.:|.:::
  Rat   376 FENPVLEA 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 31/108 (29%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
Magi2NP_446073.2 PDZ_signaling 22..96 CDD:238492
GuKc 118..291 CDD:214504 20/85 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..308 25/103 (24%)
Interaction with DDN. /evidence=ECO:0000250 302..381 31/101 (31%)
WW 304..333 CDD:395320 13/28 (46%)
WW 350..381 CDD:197736 11/30 (37%)
PDZ 428..509 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..575
PDZ 602..683 CDD:214570
MAGI_u5 687..758 CDD:406953
PDZ 775..861 CDD:214570
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 869..913
PDZ_signaling 920..1007 CDD:238492
PRK10263 <1007..>1135 CDD:236669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1011..1130
PDZ_signaling 1140..1220 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.