DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and yap1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001182697.1 Gene:yap1 / 100488779 XenbaseID:XB-GENE-952394 Length:456 Species:Xenopus tropicalis


Alignment Length:318 Identity:108/318 - (33%)
Similarity:139/318 - (43%) Gaps:103/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PIKSNNLVVRVNQDTDDNLQALFDSVLNPGDAKRPLQLPLRMRKLPNSFFTPPAP-SHSRANSAD 113
            |..:.:.:|.|..|::.:|:|||::|:||.:|..|..||:||||||:|||..|.| ||||..|. 
 Frog    13 PPPAGHQIVHVRSDSETDLEALFNAVMNPKNANVPQTLPMRMRKLPDSFFKQPEPKSHSRQAST- 76

  Fly   114 STYDAGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYN 178
                                   ||.|..|..||               |.||.|||||||    
 Frog    77 -----------------------DGGSAGALTPQ---------------HVRAHSSPASLQ---- 99

  Fly   179 VRARSDAAAANNPNANPSSQQQPAGPTFPENSAQEFPSGAPASSAIDLDAMNTCMSQDIPMSMQT 243
                   ..|.:|.|     ..|.|..         |..|||.:|                    
 Frog   100 -------LGAVSPGA-----LSPPGVV---------PGPAPAPNA-------------------- 123

  Fly   244 VHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMA 308
            .|.:|.||::...:       .||||||.|||..||.|:|||..::|.|:|||           .
 Frog   124 QHLRQSSYEIPDDV-------PLPPGWEMAKTPSGQRYFLNHMEQTTTWQDPR-----------K 170

  Fly   309 ERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHIDRTTSWNDPRM 366
            ..:.|.::...|.......|....||||||||||:|..|:.|||||.::||||.|||:
 Frog   171 AMLSQINLPAPTSPPVQQNIMTPTGPLPDGWEQALTPEGETYFINHKNKTTSWLDPRL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 47/106 (44%)
WW 266..295 CDD:395320 17/28 (61%)
WW 335..364 CDD:395320 19/28 (68%)
yap1NP_001182697.1 FAM181 <47..>95 CDD:373671 29/86 (34%)
WW 140..169 CDD:238122 17/28 (61%)
WW 197..226 CDD:366073 19/28 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11206
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1006566at2759
OrthoFinder 1 1.000 - - FOG0003509
OrthoInspector 1 1.000 - - otm47990
Panther 1 1.100 - - LDO PTHR17616
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4834
SonicParanoid 1 1.000 - - X2881
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.