DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and wwc1

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001096212.1 Gene:wwc1 / 100124763 XenbaseID:XB-GENE-985007 Length:1108 Species:Xenopus tropicalis


Alignment Length:103 Identity:36/103 - (34%)
Similarity:55/103 - (53%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 LPPGWEQAKTNDGQIYYLNHTTKSTQWEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIAN 330
            ||.|||:|:..||::||::||:|:|.|.|||.::                       |...|.|:
 Frog     8 LPEGWEEARDVDGKVYYIDHTSKTTSWIDPRDRF-----------------------TKPLTFAD 49

  Fly   331 NLG-PLPDGWEQAVTESGDLYFINHIDRTTSWNDPRMQ 367
            .:| .||.|||::......:|:|:|..:||...|||:|
 Frog    50 CIGDELPLGWEESYDTQVGVYYIDHNSQTTQIEDPRVQ 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 36/103 (35%)
WW 266..295 CDD:395320 15/28 (54%)
WW 335..364 CDD:395320 10/28 (36%)
wwc1NP_001096212.1 WW 7..39 CDD:197736 17/30 (57%)
WW 55..84 CDD:278809 10/28 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..456
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..547
C2_Kibra 655..778 CDD:176062
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 828..861
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.