Sequence 1: | NP_001350857.1 | Gene: | yki / 37851 | FlyBaseID: | FBgn0034970 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021326360.1 | Gene: | magi2b / 100001810 | ZFINID: | ZDB-GENE-141211-6 | Length: | 1171 | Species: | Danio rerio |
Alignment Length: | 228 | Identity: | 61/228 - (26%) |
---|---|---|---|
Similarity: | 99/228 - (43%) | Gaps: | 59/228 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 ARSDAAAANNPNANPSSQQQPA-GPTFPENSAQEFP----SG---APASSAIDLDAMNTCMSQDI 237
Fly 238 PM--------SMQTVHKKQRSYDV-ISP--IQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQ 291
Fly 292 WEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHID 356
Fly 357 RTTSWNDP------------RMQS-GLSVLDCP 376 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yki | NP_001350857.1 | HUL4 | <261..>404 | CDD:227354 | 38/129 (29%) |
WW | 266..295 | CDD:395320 | 13/28 (46%) | ||
WW | 335..364 | CDD:395320 | 10/28 (36%) | ||
magi2b | XP_021326360.1 | NK | <1..>29 | CDD:327404 | |
MAGI_u1 | 35..96 | CDD:318800 | 14/55 (25%) | ||
WW | 145..175 | CDD:238122 | 15/39 (38%) | ||
WW | 190..219 | CDD:306827 | 10/28 (36%) | ||
PDZ | 266..349 | CDD:214570 | |||
PDZ | 451..531 | CDD:214570 | |||
PDZ | 622..708 | CDD:214570 | |||
PDZ_signaling | 743..832 | CDD:238492 | |||
PDZ_signaling | 1034..1114 | CDD:238492 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |