DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yki and magi2b

DIOPT Version :9

Sequence 1:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster
Sequence 2:XP_021326360.1 Gene:magi2b / 100001810 ZFINID:ZDB-GENE-141211-6 Length:1171 Species:Danio rerio


Alignment Length:228 Identity:61/228 - (26%)
Similarity:99/228 - (43%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ARSDAAAANNPNANPSSQQQPA-GPTFPENSAQEFP----SG---APASSAIDLDAMNTCMSQDI 237
            ||..|......|.:.|:.::.: .|  ||...:|.|    :|   .|.||  :.:..:|..|.|:
Zfish    44 ARPSAEGKRKRNKSVSNMEKDSIEP--PEEEEEESPIINGNGIAITPESS--EHEDKSTDASGDV 104

  Fly   238 PM--------SMQTVHKKQRSYDV-ISP--IQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKSTQ 291
            |:        ::......:...|. .||  :|.|..:|:||..||.|.|..|::|:::|.||:|.
Zfish   105 PVQPCPPETPTLTATDVPEEEGDAPKSPQDLQENDDMGSLPDNWEMAYTEKGEVYFIDHNTKTTS 169

  Fly   292 WEDPRIQYRQQQQILMAERIKQNDVLQTTKQTTTSTIANNLGPLPDGWEQAVTESGDLYFINHID 356
            |.|||          :|::.|..:..:..:             ||.|||:........|:::||:
Zfish   170 WLDPR----------LAKKAKPPEECEEDE-------------LPYGWEKIDDPIYGSYYVDHIN 211

  Fly   357 RTTSWNDP------------RMQS-GLSVLDCP 376
            |.|.:.:|            :||| |||.|..|
Zfish   212 RRTQFENPVLEAKRRIQQQQQMQSQGLSALPLP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 38/129 (29%)
WW 266..295 CDD:395320 13/28 (46%)
WW 335..364 CDD:395320 10/28 (36%)
magi2bXP_021326360.1 NK <1..>29 CDD:327404
MAGI_u1 35..96 CDD:318800 14/55 (25%)
WW 145..175 CDD:238122 15/39 (38%)
WW 190..219 CDD:306827 10/28 (36%)
PDZ 266..349 CDD:214570
PDZ 451..531 CDD:214570
PDZ 622..708 CDD:214570
PDZ_signaling 743..832 CDD:238492
PDZ_signaling 1034..1114 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.