DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and GB2

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_195311.1 Gene:GB2 / 829740 AraportID:AT4G35860 Length:211 Species:Arabidopsis thaliana


Alignment Length:155 Identity:57/155 - (36%)
Similarity:82/155 - (52%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTI-EDFYRKEIEVDSSPCVLEILDTAGTEQFASM 67
            ||.:::|..|||||.|.:||....|...:|.|| .:|..:.:.||..|..|:|.||||.|.|.|:
plant     7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTVDGRPIKLQIWDTAGQESFRSI 71

  Fly    68 RDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAEGN 132
            ...|.:...|.:::|.:|..:||..::|... ..|...:....|:|:.||.||..:|.||..||.
plant    72 TRSYYRGAAGALLVYDITRRETFNHLASWLE-DARQHANPNMSIMLIGNKCDLAHKRAVSKEEGQ 135

  Fly   133 ALAQLWDCPFIEASAKDRINVNEVF 157
            ..|:.....|:||||:...||.|.|
plant   136 QFAKEHGLLFLEASARTAQNVEEAF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 51/143 (36%)
GB2NP_195311.1 PLN03108 1..210 CDD:178655 57/155 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.