DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Rhebl1

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_006521408.1 Gene:Rhebl1 / 69159 MGIID:1916409 Length:188 Species:Mus musculus


Alignment Length:182 Identity:59/182 - (32%)
Similarity:103/182 - (56%) Gaps:4/182 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAG----T 61
            :|..||.:||...|||::|..|||.|.|:|.||||:|:.|.|.:.:......|.::||||    .
Mouse     4 VRYRKVAILGYRSVGKTSLAHQFVEGEFLEGYDPTVENTYSKTVTLGKDEFHLHLVDTAGQVPVA 68

  Fly    62 EQFASMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREV 126
            ::::.:....|...||::::||:.:.::||.:.::...:....|.....:|||.||.||..:|||
Mouse    69 DEYSILPYSLIIGVHGYVLVYSVNSLRSFQIVKNLYQKLHEGHGKTRLSVLLVGNKADLSPEREV 133

  Fly   127 STAEGNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKNYCC 178
            ...||..||:.|...|:|:||:|.....:||..:::|:...:.:..:::..|
Mouse   134 QAVEGKKLAESWGAMFMESSARDNQLTQDVFIKVIQEIARVENSYGRQDRRC 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 51/152 (34%)
Rhebl1XP_006521408.1 P-loop_NTPase 6..188 CDD:393306 58/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.