DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap2b

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001030287.1 Gene:rap2b / 619592 XenbaseID:XB-GENE-493696 Length:182 Species:Xenopus tropicalis


Alignment Length:182 Identity:124/182 - (68%)
Similarity:145/182 - (79%) Gaps:0/182 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:||||||||||||||||||||:|.|||||||||||||||||||||||.||||||||||||||
 Frog     1 MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            ||||||||||.|||::|||.|.|:||||..|::.|.|||..:..|::||.||.||:.:||||..|
 Frog    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPMILVGNKVDLEGEREVSYGE 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKNYCCCTLL 182
            |.|||..|:|||:|.|||.:.:|:|:||.|||:||...:.......|.|.:|
 Frog   131 GKALADEWNCPFMETSAKHKGSVDELFAEIVRQMNYASQPNGDDRCCSCVIL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 105/148 (71%)
rap2bNP_001030287.1 Rap2 3..165 CDD:133376 117/161 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2308
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H55701
Inparanoid 1 1.050 249 1.000 Inparanoid score I3162
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm48097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3491
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.