DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and RAP1B

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001010942.1 Gene:RAP1B / 5908 HGNCID:9857 Length:184 Species:Homo sapiens


Alignment Length:187 Identity:105/187 - (56%)
Similarity:139/187 - (74%) Gaps:8/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:|:||||||||||||||||||.|.|:|||||||||.|||::|||:..|:||||||||||||.
Human     1 MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFT 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            :|||||:|||.||.::||:|...||.|:..::..|.|||.:...|::||.||.||:.:|.|...:
Human    66 AMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQ 130

  Fly   131 GNALAQLW-DCPFIEASAKDRINVNEVFATIVREMN----LTQENRQKKNYCCCTLL 182
            |..||:.| :|.|:|:|||.:|||||:|..:||::|    :..:.|:|.:   |.||
Human   131 GQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS---CQLL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 86/149 (58%)
RAP1BNP_001010942.1 Rap1 3..167 CDD:133375 97/163 (60%)
Interaction with KRIT1. /evidence=ECO:0000269|PubMed:22577140 25..67 30/41 (73%)
Effector region. /evidence=ECO:0000305 32..40 7/7 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.