DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and Rgk3

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster


Alignment Length:174 Identity:52/174 - (29%)
Similarity:88/174 - (50%) Gaps:14/174 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FKVVVLGSGGVGKSALTVQFVSGCFIEKYD-PTIEDFYRK-EIEVDSSPCVLEILDTAGTEQFAS 66
            ::|.:|||.||||.||..||.:...|..|| |..:|..:. .|.::.:...|:.| |...|.   
  Fly   235 YRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFL-TGNPES--- 295

  Fly    67 MRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGS---QPAPILLVANKFDLDCQREVST 128
             :| .::....|:|:||..:.::|   :..|.:::|::..   :..|.:|||||.||...|.||.
  Fly   296 -KD-ELEQADAFLVVYSCIDKESF---TRAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVSA 355

  Fly   129 AEGNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQ 172
            .:|..:|..:...|||.|.....|.:|:.|..:.::.|.::..|
  Fly   356 QDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 43/153 (28%)
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 51/169 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.