DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rap2l and rap2c

DIOPT Version :9

Sequence 1:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001016898.1 Gene:rap2c / 549652 XenbaseID:XB-GENE-489027 Length:183 Species:Xenopus tropicalis


Alignment Length:183 Identity:126/183 - (68%)
Similarity:149/183 - (81%) Gaps:3/183 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65
            |||:||||||||||||||||||||:|.|||||||||||||||||||||||.||||||||||||||
 Frog     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGSQPAPILLVANKFDLDCQREVSTAE 130
            ||||||||||.|||::|||.|.|:||||..|::.|.|||..:..|::||.||.||:.:|||.:||
 Frog    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLESEREVMSAE 130

  Fly   131 GNALAQLWDCPFIEASAKDRINVNEVFATIVREMNLTQENRQKKNYCC--CTL 181
            |.:|||.|.|||:|.|||.:..|:|:||.|||:||.. ...:|::.||  ||:
 Frog   131 GRSLAQEWGCPFMETSAKSKTMVDELFAEIVRQMNYA-SLPEKQDQCCTTCTV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 105/148 (71%)
rap2cNP_001016898.1 Rap2 3..165 CDD:133376 117/161 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2308
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 249 1.000 Inparanoid score I3162
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1353024at2759
OrthoFinder 1 1.000 - - FOG0000092
OrthoInspector 1 1.000 - - otm48097
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3491
SonicParanoid 1 1.000 - - X266
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.